missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NT5C1A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | NT5C1A |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18695256
|
Novus Biologicals
NBP2-48604-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18604747
|
Novus Biologicals
NBP2-48604 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NT5C1A Polyclonal antibody specifically detects NT5C1A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| NT5C1A | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS (pH 7.2), 40% Glycerol | |
| 84618 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| 5'-nucleotidase, cytosolic IA, AMP-specific 5'-NT, CN1, cN1A, CN-I, cN-IA, cytosolic 5' nucleotidase, type 1A, cytosolic 5'-nucleotidase 1A, Cytosolic 5'-nucleotidase IA, EC 3.1.3.5, MGC119199, MGC119201 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PVWEEAKIFYDNLAPKKKPKSPKPQNAVTIAVSSRALFRMDEEQQIYTEQGVEEYVRYQLEHENEPFSPGP | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title