missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
NSUN5B Polyclonal specifically detects NSUN5B in Human samples. It is validated for Western Blot.
Especificaciones
Especificaciones
| Antigen | NSUN5B |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | WBSCR20B |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human NSUN5B. Peptide sequence GTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSMCSLCQEENEDMVPDA |
| Purification Method | Affinity purified |
| Mostrar más |
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?