missing translation for 'onlineSavingsMsg'
Learn More
Learn More
nSMase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35179-20ul
This item is not returnable.
View return policy
Description
nSMase Polyclonal antibody specifically detects nSMase in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| nSMase | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| EC 3.1.4.12, ISC1, lyso-PAF-PLC, Lyso-platelet-activating factor-phospholipase C, Neutral sphingomyelinase, nSMase, N-SMase, NSMASE1, sphingomyelin phosphodiesterase 2, sphingomyelin phosphodiesterase 2, neutral membrane (neutral sphingomyelinase) | |
| A synthetic peptide corresponding to a sequence within amino acids 150-250 of human nSMase (NP_003071.2).,, Sequence:, AHRVAQAWELAQFIHHTSKKADVVLLCGDLNMHPEDLGCCLLKEWTGLHDAYLETRDFKGSEEGNTMVPKNCYVSQQELKPFPFGVRIDYVLYKAVSGFYI | |
| 20 μL | |
| Lipid and Metabolism | |
| 6610 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction