missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Nse2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | Nse2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|
18250404
|
Novus Biologicals
NBP2-58712 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18610269
|
Novus Biologicals
NBP2-58712-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
Nse2 Polyclonal specifically detects Nse2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Spezifikation
| Nse2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 286053 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| C8orf36, E3 SUMO-protein ligase NSE2, EC 6.3.2, EC 6.3.2.-, FLJ32440, hMMS21, methyl methanesulfonate sensitivity gene 21, MMS21 homolog, MMS21chromosome 8 open reading frame 36, Non-SMC element 2 homolog, non-SMC element 2 homolog (MMS21, S. cerevisiae), non-SMC element 2, MMS21 homolog (S. cerevisiae), Non-structural maintenance of chromosomes element 2 homolog, NSE2 | |
| NSMCE2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts