Invitrogen™ NSE Polyclonal Antibody

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA595555

Product Code. 16314825

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human 22RV1 whole cell, human U20S whole cell, human A431 whole cell, human HepG2 whole cell, human A549 whole cell, human SHG-44 whole cell, rat brain tissue, mouse brain tissue. IHC: human lung cancer tissue, human placenta tissue, human pancreatic cancer tissue, rat brain tissue, mouse brain tissue. ICC/IF: A431 cell. Flow: A431 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Neuron specific enolase (NSE, ENO1, ENO2, ENO3) is an enzyme that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate in the glycolytic pathway, and the reverse reaction in gluconeogenesis. NSE has a high stability in biological fluids and can easily diffuse to the extracellular medium and cerebrospinal fluid (CSF) when neuronal membranes are injured.NSE is one of three mammalian enolases, which are also known as ENO1, ENO2, and ENO3 or alternately as enolase alpha, beta and gamma. The alpha-subunit is expressed in most tissues, the beta-subunit only in muscle, and the gamma-subunit is expressed primarily in neurons, in normal and in neoplastic neuroendocrine cells. Co-expression of NSE and chromogranin A is common in neuroendocrine neoplasms. Since neurons require a great deal of energy, they are very rich in glycolytic enzymes such a GAPDH and NSE. Antibodies to NSE protein are useful to identify neuronal cell bodies, developing neuronal lineage and neuroendocrine cells. Release of NSE from damaged neurons into CSF and blood has also been used as a biomarker of neuronal injury. NSE is used clinically as a sensitive and useful marker of neuronal damage in several neurological disorders including stroke, hypoxic brain damage, status epilepticus, Creutzfeldt-Jakob disease, and herpetic encephalitis. Further, NSE is found in elevated concentrations in plasma and certain neoplasias that include pediatric neuroblastoma and small cell lung cancer.

Specifications

• Antigen: NSE
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: ENO2
• Gene Alias: 2-phospho-D-glycerate hydrolyase; 2-phospho-D-glycerate hydro-lyase; AI837106; D6Ertd375e; Eno; ENO2; Eno-2; ENOG; Enolase 2; enolase 2 (gamma, neuronal); enolase 2, gamma neuronal; enolase 2, gamma, neuronal; epididymis secretory protein Li 279; gamma enolase; gamma-enolase; gamma-enolase-like; gamma-subunit of enolase; HEL-S-279; LOC100911625; Neural enolase; neuron specific enolase; neuron specific gamma enolase; Neuronal Enolase; neuronal enriched enolase; neurone-specific enolase; neuron-specific enolase; NSE; RNEN3
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 13807, 2026, 24334
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P07323, P09104, P17183
• Gene Symbols: ENO2
• Immunogen: A synthetic peptide corresponding to a sequence of human NSE (LKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG