missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NRSN2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | NRSN2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
NRSN2 Polyclonal specifically detects NRSN2 in Human samples. It is validated for Western Blot.Specifications
| NRSN2 | |
| Polyclonal | |
| Rabbit | |
| Q9GZP1 | |
| 80023 | |
| Synthetic peptides corresponding to NRSN2(neurensin 2) The peptide sequence was selected from the middle region of NRSN2. Peptide sequence LLLLLGVAALTTGYAVPPKLEGIGEGEFLVLDQRAADYNQALGTCRLAGT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C20orf98, chromosome 20 open reading frame 98, dJ1103G7.6, FLJ23329, neurensin 2, neurensin-2 | |
| NRSN2 | |
| IgG | |
| 22 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title