missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NRIP3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | NRIP3 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
NRIP3 Polyclonal specifically detects NRIP3 in Human samples. It is validated for Western Blot.Specifications
| NRIP3 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| C11orf14, chromosome 11 open reading frame 14, nuclear receptor interacting protein 3, nuclear receptor-interacting protein 3, NY-SAR-105, Sarcoma antigen NY-SAR-105 | |
| The immunogen is a synthetic peptide directed towards the middle region of human NRIP3 (NP_065696). Peptide sequence ALVDTGCLYNLISLACVDRLGLKEHVKSHKHEGEKLSLPRHLKVVGQIEH | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 56675 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title