missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Nrf1 Antibody (1B9), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00004899-M02
This item is not returnable.
View return policy
Description
Nrf1 Monoclonal antibody specifically detects Nrf1 in Human samples. It is validated for Western Blot, ELISA
Specifications
| Nrf1 | |
| Monoclonal | |
| Unconjugated | |
| NP_005002 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA | |
| 1B9 | |
| In 1x PBS, pH 7.4 | |
| Alpha palindromic-binding protein, ALPHA-PAL, EWG, NRF-1, nuclear respiratory factor 1 | |
| NRF1 (NP_005002, 201 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPWANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQ | |
| 0.1 mg | |
| Endocrinology, Neurodegeneration, Neuroscience | |
| 4899 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG1 κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction