missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NRAS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38443-20ul
This item is not returnable.
View return policy
Description
NRAS Polyclonal antibody specifically detects NRAS in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| NRAS | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| ALPS4, GTPase NRas, HRAS1, neuroblastoma RAS viral (v-ras) oncogene homolog, N-ras, N-ras protein part 4, NRAS1, NS6, Transforming protein N-Ras, v-ras neuroblastoma RAS viral oncogene homolog | |
| A synthetic peptide corresponding to a sequence within amino acids 90-189 of human NRAS (NP_002515.1).,, Sequence:, FADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM | |
| 20 μL | |
| Breast Cancer, Cancer, Cell Cycle and Replication, mTOR Pathway | |
| 4893 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction