Novus Biologicals NRAMP2/SLC11A2/DMT1 Antibody (2F7), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00004891-M06

Product Code. 18309538

Description

NRAMP2/SLC11A2/DMT1 Monoclonal antibody specifically detects NRAMP2/SLC11A2/DMT1 in Human samples. It is validated for Western Blot, ELISA, ELISA

Specifications

• Antigen: NRAMP2/SLC11A2/DMT1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: DCT1NRAMP 2, Divalent cation transporter 1, Divalent metal transporter 1, DMT-1, DMT1FLJ37416, member 2, NRAMP2natural resistance-associated macrophage protein 2, solute carrier family 11 (proton-coupled divalent metal ion transporters)
• Immunogen: SLC11A2 (NP_000608, 1 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF
• Quantity: 0.1 mg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, ELISA, Sandwich ELISA
• Clone: 2F7
• Dilution: Western Blot 1:500, ELISA, Sandwich ELISA
• Gene Accession No.: NP_000608
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4891
• Content And Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Isotype: IgG2a κ