missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18392159

NRAMP1/SLC11A1 Antibody (2G2), Novus Biologicals™

Product Code. 18392159 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18392159 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18392159 Supplier Novus Biologicals Supplier No. H00006556M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

NRAMP1/SLC11A1 Monoclonal antibody specifically detects NRAMP1/SLC11A1 in Human, Mouse, Bovine samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen NRAMP1/SLC11A1
Applications Western Blot, ELISA
Classification Monoclonal
Clone 2G2
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_000569
Gene Alias natural resistance-associated macrophage protein 1, LSH, member 1, NRAMP 1, NRAMP1solute carrier family 11 (sodium/phosphate symporters), member 1, NRAMPnatural resistance-associated macrophage protein 1, solute carrier family 11 (proton-coupled divalent metal ion transporters)
Host Species Mouse
Immunogen SLC11A1 (NP_000569.2, 308 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGV
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6556
Target Species Human, Mouse, Bovine
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.