missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NPY4R Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38511-100ul
This item is not returnable.
View return policy
Description
NPY4R Polyclonal antibody specifically detects NPY4R in Human samples. It is validated for ELISA,Western Blot
Specifications
| NPY4R | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| neuropeptide Y receptor type 4, NPY4RMGC116897, pancreatic polypeptide receptor 1NPY4-R, PP1Y4 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human NPY4R (NP_005963.4).,, Sequence:, MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNLCLMCVTVRQKEKANVTNLLI | |
| 100 μL | |
| GPCR, Neuroscience, Neurotransmission | |
| 5540 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction