NPL Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17138-25UL

Product Code. 18341715

Description

NPL Polyclonal antibody specifically detects NPL in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: NPL
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: C112, C1orf13MGC61869, chromosome 1 open reading frame 13, DHDPS1, dihydrodipicolinate synthetase homolog 1, EC 4.1.3.3, MGC149582, N-acetylneuraminate lyase, N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase), N-acetylneuraminate pyruvate-lyase, N-acetylneuraminic acid aldolase, NAL, NALase, NPL1, Sialate lyase, Sialate-pyruvate lyase, Sialic acid aldolase, Sialic acid lyase
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FVNGTTGEGLSLSVSERRQVAEEWVTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGAD
• Quantity: 25 μg
• Research Discipline: Endocrinology, Signal Transduction
• Gene ID (Entrez): 80896
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified