missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NPL Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17138-100UL
This item is not returnable.
View return policy
Description
NPL Polyclonal antibody specifically detects NPL in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| NPL | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| C112, C1orf13MGC61869, chromosome 1 open reading frame 13, DHDPS1, dihydrodipicolinate synthetase homolog 1, EC 4.1.3.3, MGC149582, N-acetylneuraminate lyase, N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase), N-acetylneuraminate pyruvate-lyase, N-acetylneuraminic acid aldolase, NAL, NALase, NPL1, Sialate lyase, Sialate-pyruvate lyase, Sialic acid aldolase, Sialic acid lyase | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: FVNGTTGEGLSLSVSERRQVAEEWVTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGAD | |
| 100 μg | |
| Endocrinology, Signal Transduction | |
| 80896 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction