missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
NPAS2 Monoclonal antibody specifically detects NPAS2 in Human samples. It is validated for Western Blot, ELISA
Specifications
Specifications
| Antigen | NPAS2 |
| Applications | Western Blot, ELISA |
| Classification | Monoclonal |
| Clone | 3B1 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_002509 |
| Gene Alias | Basic-helix-loop-helix-PAS protein MOP4, BHLHE9, bHLHe9MGC71151, Class E basic helix-loop-helix protein 9, Member of PAS protein 4, member of PAS superfamily 4, MOP4PAS domain-containing protein 4, neuronal PAS domain protein 2, neuronal PAS domain-containing protein 2, Neuronal PAS2, PASD4FLJ23138 |
| Host Species | Mouse |
| Immunogen | NPAS2 (NP_002509, 646 a.a. ~ 738 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NLTTPASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLH |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?