missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NPAS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | NPAS1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18220155
|
Novus Biologicals
NBP2-58842 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18635638
|
Novus Biologicals
NBP2-58842-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NPAS1 Polyclonal specifically detects NPAS1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| NPAS1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 4861 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VLWVSHVLSQAEGGQTPLDAFQLPASVACEEASSPGPEPTEPEPPTEGKQAAPAENEAPQTQGQRIKV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Basic-helix-loop-helix-PAS protein MOP5, BHLHE11, bHLHe11member of PAS superfamily 5, Class E basic helix-loop-helix protein 11, Member of PAS protein 5, MOP5Neuronal PAS1, neuronal PAS domain protein 1, neuronal PAS domain-containing protein 1, PASD5PAS domain-containing protein 5 | |
| NPAS1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title