Invitrogen™ NOX4 Polyclonal Antibody

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA595503

Product Code. 16394765

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human 293T whole cell, human U87 whole cell, human SH-SY5Y whole cell, human U251 whole cell, human U2OS whole cell, human Hela whole cell, human T47D whole cell, monkey COS-7 whole cell. ICC/IF: U2OS cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Oxygen sensing is essential for homeostasis in all aerobic organisms. A phagocyte-type oxidase, similar to that responsible for the production of large amounts of reactive oxygen species (ROS) in neutrophil granulocytes, with resultant antimicrobial activity, has been postulated to function in the kidney as an oxygen sensor that regulates the synthesis of erythropoietin in the renal cortex. NOX4 has a role as a redox messenger in the activation of intracellular signaling pathways leading (or contributing) to mitochondriogenesis, cell survival, and differentiation in hematopoietic stem cells. Data suggests that NOX4 provides a novel link between the insulin receptor and the generation of cellular reactive oxygen species that enhances insulin signal transduction.

Specifications

• Antigen: NOX4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Nox4
• Gene Alias: AI648021; kidney oxidase-1; Kidney superoxide-producing NADPH oxidase; KOX; KOX1; KOX-1; NADPH oxidase 4; NOX 4; NOX4; NOX-4; renal NAD(P)H-oxidase; RENOX; superoxide-generating NADPH oxidase 4
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 50507
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: Q9NPH5
• Gene Symbols: Nox4
• Immunogen: A synthetic peptide corresponding to a sequence of human NADPH oxidase 4 (ILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLL).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Monkey, Rat
• Product Type: Antibody
• Isotype: IgG