missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 18257752

Novus Biologicals™ Recombinant Human PP2C gamma/PPM1G His Protein

Product Code. 18257752 Shop All Bio Techne Products
Click to view available options
:
0.1mg; Unlabeled
This item is not returnable. View return policy

Product Code. 18257752

Brand: Novus Biologicals™ NBC118399

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 317-546 of Human PP2C gamma/PPM1G The Recombinant Human PP2C gamma/PPM1G Protein is derived from E. coli. The Recombinant Human PP2C gamma/PPM1G Protein has been validated for the following applications: SDS-Page.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number NP_002698
For Use With (Application) ELISA, SDS-PAGE
Formulation 25mM Tris buffer (pH 7.5), 1mM DTT, 1mM EDTA, 2mM beta-mercaptoethanol, 20% glycerol
Gene ID (Entrez) 5496
Molecular Weight (g/mol) 27kDa
Name PP2C gamma/PPM1G Protein
Purification Method Protein
Immunogen MGSSHHHHHHSSGLVPRGSHMEGKEEPGSDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKKKKAKRD
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Cross Reactivity Human
Purity or Quality Grade >90%, by SDS-PAGE
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.