missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 18040056

Novus Biologicals™ Recombinant Human GADD153/CHOP His Protein

Product Code. 18040056 Shop All Bio Techne Products
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.1mg
This item is not returnable. View return policy

Product Code. 18040056

Brand: Novus Biologicals™ NBC118430

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids1-169 of Human GADD153/CHOP The Recombinant Human GADD153/CHOP Protein is derived from E. coli. The Recombinant Human GADD153/CHOP Protein has been validated for the following applications: SDS-Page.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number NP_004074
Concentration 1 mg/mL
For Use With (Application) SDS-PAGE
Formulation 20 mM Tris-HCl buffer (pH 8.0), 20% Glycerol
Gene ID (Entrez) 1649
Molecular Weight (g/mol) M.W. (theoretical): 21.3 kDa
Name GADD153/CHOP Protein
Purification Method Protein
Quantity 0.1 mg
Immunogen MGSSHHHHHHSSGLVPRGSHMAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
Storage Requirements Store at 4 C short term. Aliquot and store (at -20 C long term. Avoid freeze-thaw cycles.)
Gene Symbol DDIT3
Cross Reactivity Human
Research Category Cell Cycle and Replication, DNA Repair, Hypoxia, Unfolded Protein Response
Purity or Quality Grade >90%, by SDS-PAGE
Protein GADD153/CHOP
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.