missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Recombinant Human GADD153/CHOP His Protein
Shop All Bio Techne Products
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.1mg
Description
A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids1-169 of Human GADD153/CHOP The Recombinant Human GADD153/CHOP Protein is derived from E. coli. The Recombinant Human GADD153/CHOP Protein has been validated for the following applications: SDS-Page.
Specifications
Specifications
| Accession Number | NP_004074 |
| Concentration | 1 mg/mL |
| For Use With (Application) | SDS-PAGE |
| Formulation | 20 mM Tris-HCl buffer (pH 8.0), 20% Glycerol |
| Gene ID (Entrez) | 1649 |
| Molecular Weight (g/mol) | M.W. (theoretical): 21.3 kDa |
| Name | GADD153/CHOP Protein |
| Purification Method | Protein |
| Quantity | 0.1 mg |
| Immunogen | MGSSHHHHHHSSGLVPRGSHMAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA |
| Show More |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction