missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18247772

Novus Biologicals™ Glycerol Kinase Antibody Blocking Peptide

Product Code. 18247772 Shop All Bio Techne Products
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
This item is not returnable. View return policy

Product Code. 18247772

Brand: Novus Biologicals™ NBP157033PEP

Please to purchase this item. Need a web account? Register with us today!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 View alternative products

This item is not returnable. View return policy

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A blocking peptide from human Glycerol Kinase. Source: Synthetic Amino Acid Sequence: (Accession #: NP_976325)MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS The Glycerol Kinase Blocking Peptide is derived from Synthetic. The Glycerol Kinase Blocking Peptide has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Specifications

Gene ID (Entrez) 2710
Species Human
Content And Storage Store at -20 C. Avoid freeze-thaw cycles.
Formulation Lyophilized with sterile distilled water.
For Use With (Application) This Peptide is Useful as a Blocking Peptide for NBP1-57033. This Synthetic Peptide is Designed for Use in an Antibody Competition Assay with Its Corresponding Antibody. Use of This Product in Any Other Assay Has Not Yet Been Tested. For Further Blocking Peptide Related Protocol, Click Here .
Gene Alias ATP:glycerol 3-phosphotransferase, EC 2.7.1.30, GK1, GKD, Glycerokinase, glycerol kinase
Gene Symbol GK
Molecular Weight (g/mol) 58kDa
Product Type Glycerol Kinase
Quantity 100 μg
Regulatory Status RUO - research use only
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.