missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NOR1/OSCP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | NOR1/OSCP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
NOR1/OSCP1 Polyclonal specifically detects NOR1/OSCP1 in Human samples. It is validated for Western Blot.Specifications
| NOR1/OSCP1 | |
| Polyclonal | |
| Rabbit | |
| A6NIN9 | |
| 127700 | |
| Synthetic peptides corresponding to C1orf102 (organic solute carrier partner 1) The peptide sequence was selected from the N terminal of C1orf102)(50ug). Peptide sequence ARKVLNDIISTMFNRKFMEELFKPQELYSKKALRTVYERLAHASIMKLNQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C1orf102, NOR1, OSCP1 organic solute carrier partner 1 | |
| OSCP1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title