NOP10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56381

Product Code. 18233412

Description

NOP10 Polyclonal specifically detects NOP10 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NOP10
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: H/ACA ribonucleoprotein complex subunit 3, homolog of yeast Nop10p, MGC70651, NOLA3Nucleolar protein family A member 3, NOP10 ribonucleoprotein homolog (yeast), NOP10P, Nucleolar protein 10, nucleolar protein family A, member 3 (H/ACA small nucleolar RNPs), snoRNP protein NOP10
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: 3.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NPE3
• Gene Symbols: NOP10
• Immunogen: Synthetic peptides corresponding to NOLA3 The peptide sequence was selected from the middle region of NOLA3. Peptide sequence MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK.
• Quantity: 100 μL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 55505
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.