missing translation for 'onlineSavingsMsg'
Learn More

non-muscle Myosin IIA Antibody (3C7), Novus Biologicals™

Product Code. 18377847 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
50 μg
Unit Size:
50µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18377847 50 μg 50µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18377847 Supplier Novus Biologicals Supplier No. H00004627M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

non-muscle Myosin IIA Monoclonal antibody specifically detects non-muscle Myosin IIA in Human, Mouse samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Frozen), ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen non-muscle Myosin IIA
Applications Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Frozen), Sandwich ELISA
Classification Monoclonal
Clone 3C7
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Alias Cellular myosin heavy chain, type A, DFNA17, EPSTS, FTNSNMMHC-IIA, MGC104539, MHANMMHC II-a, MYH9 variant protein, Myosin heavy chain 9, Myosin heavy chain, non-muscle IIa, myosin, heavy chain 9, non-muscle, myosin, heavy polypeptide 9, non-muscle, myosin-9, NMHC-II-A, NMMHCA, NMMHC-A, Non-muscle myosin heavy chain A, nonmuscle myosin heavy chain II-A, Non-muscle myosin heavy chain IIa, non-muscle myosin heavy polypeptide 9
Host Species Mouse
Immunogen MYH9 (NP_002464.1, 1871 a.a. ~ 1960 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE
Quantity 50 μg
Regulatory Status RUO
Research Discipline Cell Biology, Cellular Markers
Primary or Secondary Primary
Gene ID (Entrez) 4627
Target Species Human, Mouse
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Ascites
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.