non-muscle heavy chain 10 Myosin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35203-20ul

Product Code. 30226629

Description

non-muscle heavy chain 10 Myosin Polyclonal antibody specifically detects non-muscle heavy chain 10 Myosin in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: non-muscle heavy chain 10 Myosin
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, ELISA
• Gene Alias: Cellular myosin heavy chain, type B, cellular myosin heavy chain, type B type B, heavy polypeptide 10, non-muscle, MGC134913, MGC134914, Myosin heavy chain 10, Myosin heavy chain, non-muscle IIb, myosin heavy chain, nonmuscle type B, myosin, heavy chain 10, non-muscle, myosin-10, near to the ATP binding region, NMMHC II-b, NMMHCB, NMMHC-B, NMMHC-IIB, Non-muscle myosin heavy chain B, nonmuscle myosin heavy chain IIB, Non-muscle myosin heavy chain IIb, nonmuscle myosin heavy chain-B, nonmuscle myosin II heavy chain-B
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1908-2007 of human non-muscle heavy chain 10 Myosin (NP_001242941.1).,, Sequence:, ARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQSE
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4628
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG