missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NOMO1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | NOMO1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
NOMO1 Polyclonal specifically detects NOMO1 in Human samples. It is validated for Western Blot.Specifications
| NOMO1 | |
| Polyclonal | |
| Rabbit | |
| NP_055102 | |
| 23420 | |
| Synthetic peptide directed towards the N terminal of human NOMO1The immunogen for this antibody is NOMO1. Peptide sequence DGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATGFSVC. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NODAL modulator 1, Nomo, NOMO3, pM5 protein 3, pM5 protein, telomeric copy | |
| NOMO1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title