NOLC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-58200

Product Code. 18286762

Description

NOLC1 Polyclonal specifically detects NOLC1 in Human, Zebrafish samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NOLC1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 140 kDa nucleolar phosphoprotein, HCV NS5A trans-regulated protein 13, HCV NS5A-transactivated protein 13, Hepatitis C virus NS5A-transactivated protein 13, KIAA0035NS5ATP13, NOPP130, NOPP140, Nucleolar 130 kDa protein, nucleolar and coiled-body phosphoprotein 1, nucleolar and coiled-body phosphprotein 1, Nucleolar phosphoprotein p130, nucleolar protein p130, P130
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Goat: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%; Xenopus: 92%; Chicken: 92%.
• Target Species: Human, Zebrafish, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Yeast
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q14978
• Gene Symbols: NOLC1
• Immunogen: Synthetic peptides corresponding to NOLC1(nucleolar and coiled-body phosphoprotein 1) The peptide sequence was selected from the C terminal of NOLC1. Peptide sequence: DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ.
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 9221
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only