Nodal Antibody (5C3), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00004838-M03

Product Code. 18325908

Description

Nodal Monoclonal antibody specifically detects Nodal in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Nodal
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: MGC138230, nodal homolog, nodal homolog (mouse), nodal, mouse, homolog
• Immunogen: NODAL (NP_060525, 275 a.a. ~ 346 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGC
• Quantity: 0.1 mg
• Research Discipline: Cytokine Research, Stem Cell Signaling Pathway
• Gene ID (Entrez): 4838
• Content And Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Isotype: IgG1 κ

• Applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
• Clone: 5C3
• Dilution: Western Blot 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
• Gene Accession No.: NP_060525
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified