missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NOD2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£240.00 - £410.00
Specifications
| Antigen | NOD2 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18686055
|
Novus Biologicals
NBP2-48752-25ul |
25 μL |
£240.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18618585
|
Novus Biologicals
NBP2-48752 |
0.1 mL |
£410.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NOD2 Polyclonal antibody specifically detects NOD2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| NOD2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Autophagy, Cancer, Caspases, Cell Biology | |
| PBS (pH 7.2), 40% Glycerol | |
| 64127 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| BLAU, CARD15caspase recruitment domain protein 15, caspase recruitment domain family, member 15, Caspase recruitment domain-containing protein 15, CDACUG, CLR16.3, IBD1NLR family, CARD domain containing 2, Inflammatory bowel disease protein 1, NLRC2, NOD-like receptor C2, nucleotide-binding oligomerization domain 2, nucleotide-binding oligomerization domain containing 2, nucleotide-binding oligomerization domain, leucine rich repeat and CARD domaincontaining 2, nucleotide-binding oligomerization domain-containing protein 2, PSORAS1NOD2B | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPI | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title