missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NOC3L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | NOC3L |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18266272
|
Novus Biologicals
NBP2-56518 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18618927
|
Novus Biologicals
NBP2-56518-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NOC3L Polyclonal specifically detects NOC3L in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| NOC3L | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 64318 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IQELTIEEHLIERKKKLQEKKMHIAALASAILSDPENNIKKLKELRSMLMEQDPDVAVTVRKLVIVSLME | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| AD24NOC3-like protein, C10orf117, chromosome 10 open reading frame 117, Factor for adipocyte differentiation 24, FAD24NOC3 protein homolog, FLJ12820, nucleolar complex associated 3 homolog (S. cerevisiae), nucleolar complex protein 3 homolog, Nucleolar complex-associated protein 3-like protein | |
| NOC3L | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title