missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NNT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | NNT |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
NNT Polyclonal specifically detects NNT in Human samples. It is validated for Western Blot.Specifications
| NNT | |
| Polyclonal | |
| Rabbit | |
| Q13423 | |
| 23530 | |
| Synthetic peptides corresponding to NNT(nicotinamide nucleotide transhydrogenase) The peptide sequence was selected from the N terminal of NNT. Peptide sequence IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| MGC126502, mitochondrial, nicotinamide nucleotide transhydrogenaseMGC126503, Pyridine nucleotide transhydrogenase | |
| NNT | |
| IgG | |
| 114 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title