NME7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-83482

Product Code. 18263517

Description

NME7 Polyclonal specifically detects NME7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NME7
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: EC 2.7.4.6, FLJ37194, MN23H7, NDK 7, NDP kinase 7, nm23-H7, non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase), nucleoside diphosphate kinase 7, nucleoside-diphosphate kinase 7
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: NME7
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKI
• Quantity: 0.1 mL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 29922
• Target Species: Human
• Isotype: IgG

For Research Use Only