NMDARA1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18475381	Novus Biologicals NBP1-92187-25ul	25 μL

Description

NMDARA1 Polyclonal specifically detects NMDARA1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NMDARA1
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 2907
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PYGQPQVFPGQDPDSPQHGNYQEEGPPSYYDNQDFPATNWDDKSIRQAFIRK
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: glutamate [NMDA] receptor-associated protein 1, glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1(glutamate binding), glutamate receptor, NMDA subtype, glutamate-binding subunit, HNRGW, LFG1, NMDA receptor glutamate-binding subunit, NMDARA1MGC99687, Putative MAPK-activating protein PM02, TMBIM3, transmembrane BAX inhibitor motif containing 3
• Gene Symbols: GRINA
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only