missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NMDAR2A Rabbit anti-Human, Rat, Polyclonal, Novus Biologicals™

NMDAR2A Rabbit anti-Human, Rat, Polyclonal, Novus Biologicals™

Product Code. 18398986 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18398986 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18398986 Supplier Novus Biologicals Supplier No. NBP310351100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

NMDAR2A Polyclonal specifically detects NMDAR2A in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry.
TRUSTED_SUSTAINABILITY

Specifications

Antigen NMDAR2A
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Formulation PBS buffer, 2% sucrose
Gene Alias GluN2A, glutamate receptor, ionotropic, N-methyl D-aspartate 2A, hNR2A, NMDA receptor subtype 2A, N-methyl D-aspartate receptor subtype 2A, N-methyl-D-aspartate receptor subunit 2A, subunit epsilon-1
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NMDAR2A (NP_000824). Peptide sequence DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Neuroendocrinology, Neuronal Cell Markers, Neuroscience, Neurotransmission, Vision
Primary or Secondary Primary
Gene ID (Entrez) 2903
Target Species Human, Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.