NLRP5 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Marke:  Novus Biologicals NBP2-93564-0.02ml

Artikelnummer. 18665571

Beschreibung

NLRP5 Polyclonal antibody specifically detects NLRP5 in Human, Mouse, Rat samples. It is validated for Western Blot

Spezifikation

• Antigen: NLRP5
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: CLR19.8, MATERMater protein homolog, NACHT, leucine rich repeat and PYD containing 5, NACHT, LRR and PYD domains-containing protein 5, NALP5maternal antigen that embryos require, NLR family, pyrin domain containing 5, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 5, PAN11, PYPAF8
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 157-256 of human NLRP5 (NP_703148.4). TMTDQGPSKEKVPGISQAVQQDSATAAETKEQEISQAMEQEGATAAETEEQEISQAMEQEGATAAETEEQGHGGDTWDYKSHVMTKFAEEEDVRRSFENT
• Quantity: 0.02 mL
• Research Discipline: Stem Cell Signaling Pathway
• Gene ID (Entrez): 126206
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified