missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NLRP3/NALP3 Antibody, Novus Biologicals™

NLRP3/NALP3 Antibody, Novus Biologicals™

Product Code. 18411742 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18411742 25 μL 25µL
18717363 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18411742 Supplier Novus Biologicals Supplier No. NBP19020725ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody has been used in 6 publications

NLRP3/NALP3 Polyclonal specifically detects NLRP3/NALP3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen NLRP3/NALP3
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q96P20
Gene Alias AII, AII/AVP, Angiotensin/vasopressin receptor AII/AVP-like, AVP, C1orf7, Caterpiller protein 1.1, CLR1.1, Cold autoinflammatory syndrome 1, Cold autoinflammatory syndrome 1 protein, Cryopyrin, Familial cold autoinflammatory syndrome, FCU, Leucine-rich repeat-, and PYD-containing protein 3, Muckle-Wells syndrome, MWS, NACHT, LRR and PYD containing protein 3, NACHT, LRR and PYD domains-containing protein 3, NALP3, NLR family, pyrin domain containing 3, NLRP3, Nucleotide-Binding Oligomerization Domain, Leucine Rich Repeat And Pyrin Domain Containing 3, PYPAF1, PYRIN-containing APAF1-like protein 1
Gene Symbols NLRP3
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to NLRP3/NALP3 Antibody amino acids: FKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPTVICQEDSIEEEWMGLLEYLSRISICKMKKDYRKKYR
Molecular Weight of Antigen 118 kDa
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Alzheimers Research, Apoptosis, Cancer, Cardiovascular Biology, Cytokine Research, Immunology, Inflammation, Neurodegeneration, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 114548
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.