missing translation for 'onlineSavingsMsg'
Learn More

NLRP11 Antibody, Novus Biologicals™

Product Code. 18464651 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
Unit Size:
25µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18464651 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18464651 Supplier Novus Biologicals Supplier No. NBP19218625ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

NLRP11 Polyclonal specifically detects NLRP11 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen NLRP11
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias CLR19.6, NACHT, leucine rich repeat and PYD containing 11, NALP11NACHT, LRR and PYD domains-containing protein 11, NLR family, pyrin domain containing 11, NOD17PYPAF7, Nucleotide-binding oligomerization domain protein 17, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 11, PAAD- and NACHT-containing protein 10, PAAD- and NACHT-containing protein 10B, PAAD-and NACHT domain-containing protein 10, PAN10FLJ26273, PYPAF6NACHT, LRR and PYD containing protein 11, PYRIN-containing APAF1-like protein 6
Gene Symbols NLRP11
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HLGNDGVAKLLESLISPDCVLKVVGLPLTGLNTQTQQLLMTVKERKPSLIFLSETWSLKEGREIGVTPASQPGSIIPNSNLDYMFFKFPRMSAAMRTSNTASR
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 204801
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.