missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NKp80/KLRF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

NKp80/KLRF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18341324 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18341324 25 μg 25µL
18360877 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18341324 Supplier Novus Biologicals Supplier No. NBP31728325UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

NKp80/KLRF1 Polyclonal antibody specifically detects NKp80/KLRF1 in Human samples. It is validated for Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen NKp80/KLRF1
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias Activating coreceptor NKp80, CLEC5CMGC119908, C-type lectin domain family 5 member C, killer cell lectin-like receptor F1, killer cell lectin-like receptor subfamily F member 1, killer cell lectin-like receptor subfamily F, member 1, Lectin-like receptor F1, MGC119907, MGC119909, ML, NKp80
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: GSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLER
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Immunology
Primary or Secondary Primary
Gene ID (Entrez) 51348
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.