missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NKIRAS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | NKIRAS2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
NKIRAS2 Polyclonal specifically detects NKIRAS2 in Human samples. It is validated for Western Blot.Specifications
| NKIRAS2 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| DKFZP434N1526, I-kappa-B-interacting Ras-like protein 2, Kappa B-Ras protein 2, KappaB-Ras2, KBRAS2DKFZp434N1526, MGC74742, NF-kappa-B inhibitor-interacting Ras-like protein 2, NFKB inhibitor interacting Ras-like 2, NFKB inhibitor interacting Ras-like protein 2 | |
| NKIRAS2 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9NYR9 | |
| 28511 | |
| Synthetic peptides corresponding to NKIRAS2(NFKB inhibitor interacting Ras-like 2) The peptide sequence was selected from the middle region of NKIRAS2. Peptide sequence KKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title