missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ NKG2D (CD314) Polyclonal Antibody
GREENER_CHOICE

Product Code. 15985135
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
15985135 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 15985135 Supplier Invitrogen™ Supplier No. PA579570

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat lymph tissue, rat spleen tissue, mouse thymus tissue.

Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. NK cells can regulate specific humoral and cell-mediated immunity, and preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. The NK gene encodes a member of the NKG2 family, and the encoded transmembrane protein is characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells.
TRUSTED_SUSTAINABILITY

Specifications

Antigen NKG2D (CD314)
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene Klrk1
Gene Accession No. O54709, O70215, P26718
Gene Alias CD314; D12S2489E; D6H12S2489E; killer cell lectin like receptor K1; Killer cell lectin-like receptor subfamily K member 1; killer cell lectin-like receptor subfamily K, member 1; KLR; Klrk1; natural killer cell group 2D; natural killer cell receptor; NK cell receptor D; NK lectin-like receptor; Nkg2d; NKG2-D; NKG2-D type II integral membrane protein; NKG2-D-activating NK receptor; NKLLR; Nkrp2; NKR-P2; NKR-P2, ortholog of human NKG2D
Gene Symbols Klrk1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human NKG2D (YQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYH).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 22914, 24934, 27007
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.