NKD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Brand:  Novus Biologicals NBP2-13658

Product Code. 18056015

Description

NKD2 Polyclonal specifically detects NKD2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NKD2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: Dvl-binding protein NKD2, hNkd2, naked cuticle homolog 2 (Drosophila), naked cuticle-2, Naked2, Naked-2, protein naked cuticle homolog 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: NKD2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GHKRYRQKGREGHSPLKAPHAQPATVEHEVVRDLPPTPAGEGYAVPVIQRHE
• Quantity: 0.1 mL
• Research Discipline: Wnt Signaling Pathway
• Gene ID (Entrez): 85409
• Target Species: Human
• Isotype: IgG

For Research Use Only