missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NKCC2/SLC12A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35298-20ul
This item is not returnable.
View return policy
Description
NKCC2/SLC12A1 Polyclonal antibody specifically detects NKCC2/SLC12A1 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| NKCC2/SLC12A1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| BSC1, Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2, Kidney-specific Na-K-Cl symporter, MGC48843, NKCC2A variant A, NKCC2Na-K-2Cl cotransporter, solute carrier family 12 (sodium/potassium/chloride transporters), member 1, solute carrier family 12 member 1 | |
| A synthetic peptide corresponding to a sequence within amino acids 50-150 of human NKCC2/SLC12A1 (NP_000329.2).,, Sequence:, FGDEAQKRLRISFRPGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSAD | |
| 20 μL | |
| ABC Transporters, Cancer, Neuroscience | |
| 6557 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction