missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18374439

NKCC2/SLC12A1 Antibody (4H4), Novus Biologicals™

Product Code. 18374439 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18374439 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18374439 Supplier Novus Biologicals Supplier No. H00006557M03

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

NKCC2/SLC12A1 Monoclonal antibody specifically detects NKCC2/SLC12A1 in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen NKCC2/SLC12A1
Applications Western Blot, ELISA
Classification Monoclonal
Clone 4H4
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_000329
Gene Alias BSC1, Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2, Kidney-specific Na-K-Cl symporter, MGC48843, NKCC2A variant A, NKCC2Na-K-2Cl cotransporter, solute carrier family 12 (sodium/potassium/chloride transporters), member 1, solute carrier family 12 member 1
Host Species Mouse
Immunogen SLC12A1 (NP_000329.1, 80 a.a. ~ 172 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSADRVANGDGIPGDEQAENKEDDQA
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline ABC Transporters, Cancer, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 6557
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.