missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NIPA2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | NIPA2 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
NIPA2 Polyclonal specifically detects NIPA2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| NIPA2 | |
| Unconjugated | |
| RUO | |
| magnesium transporter NIPA2, MGC5466, non imprinted in Prader-Willi/Angelman syndrome 2 | |
| NIPA2 | |
| IgG |
| Polyclonal | |
| Rabbit | |
| NP_001008860 | |
| 81614 | |
| Synthetic peptide directed towards the middle region of human NIPA2. Peptide sequence VYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWILLLSLIVCV. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title