NIP30 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-55946-25ul

Product Code. 18628138

Description

NIP30 Polyclonal specifically detects NIP30 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: NIP30
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: C16orf94, chromosome 16 open reading frame 94, family with sequence similarity 192, member A, FLJ21799, MGC74898, NEFA-interacting nuclear protein NIP30, NIP30CDA018
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 80011
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PSME3IP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KRLKPDPEPDDKNQEPSSCKSLGNTSLSGPSIHCPSAAVCIGILPGLGAYSGSSD
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only