missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NIP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | NIP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
NIP Polyclonal specifically detects NIP in Human samples. It is validated for Western Blot.Specifications
| NIP | |
| Polyclonal | |
| Rabbit | |
| NP_653166 | |
| 90527 | |
| The specific Immunogen is proprietary information. Peptide sequence PEEGGLLSPRYRSMADSPKSQDIPLSEASSTKAYYRPRRLSLVPADVRGL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Dual oxidase activator 1, dual oxidase maturation factor 1, dual oxidase maturation factor 1 delta, dual oxidase maturation factor 1 gamma, FLJ32334, homolog of Drosophila Numb-interacting protein, mol, NIPdual oxidase maturation factor 1 alpha, Numb-interacting protein, NUMBIPdual oxidase maturation factor 1 beta | |
| DUOXA1 | |
| IgG | |
| 53 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title