missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NIF3L1 Antibody, Novus Biologicals™

NIF3L1 Antibody, Novus Biologicals™

Product Code. 30232810 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30232810 20 μL 20µL
30232960 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30232810 Supplier Novus Biologicals Supplier No. NBP33355220ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

NIF3L1 Monoclonal antibody specifically detects NIF3L1 in Human,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen NIF3L1
Applications ELISA, Western Blot
Classification Monoclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL
Formulation PBS (pH 7.3), 50% glycerol, 0.05% BSA
Gene Alias ALS2CR1, candidate 1, MDS015, NIF3 NGG1 interacting factor 3-like 1 (S. pombe), NIF3-like protein 1, S.pombe homolog)-like 1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human NIF3L1 (Q9GZT8).,, Sequence:, MGRLCTLDESVSLATMIDRIKRHLKLSHIRLALGVGRTLESQVKVVALCAGSGSSVLQGVEADLYLTGEMSHHDTLDAASQGINVILCEHSNTERGFLSDL
Purification Method Affinity purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 60491
Target Species Human, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.