missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Nidogen-2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Nidogen-2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Nidogen-2 Polyclonal specifically detects Nidogen-2 in Human samples. It is validated for Western Blot.Specifications
| Nidogen-2 | |
| Polyclonal | |
| Rabbit | |
| Q14112 | |
| 22795 | |
| Synthetic peptides corresponding to NID2(nidogen 2 (osteonidogen)) The peptide sequence was selected from the middle region of NID2. Peptide sequence DDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRSQPGTTPACIPTVAPPMV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NID-2, nidogen 2 (osteonidogen), nidogen-2, osteonidogen | |
| NID2 | |
| IgG | |
| 148 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title