missing translation for 'onlineSavingsMsg'
Learn More

Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (2G5), Novus Biologicals™

Product Code. 18320138 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.1mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18320138 0.1 mg 0.1mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18320138 Supplier Novus Biologicals Supplier No. H00001134M04

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

Nicotinic Acetylcholine R alpha 1/CHRNA1 Monoclonal antibody specifically detects Nicotinic Acetylcholine R alpha 1/CHRNA1 in Human samples. It is validated for ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen Nicotinic Acetylcholine R alpha 1/CHRNA1
Applications ELISA
Classification Monoclonal
Clone 2G5
Conjugate Unconjugated
Dilution ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_000070
Gene Alias acetylcholine receptor subunit alpha, ACHRA, ACHRD, CHNRA, cholinergic receptor, nicotinic, alpha 1 (muscle), CHRNA, CMS2A, FCCMS, nicotinic acetylcholine receptor alpha subunit, nicotinic cholinergic receptor alpha 1, nicotinic, alpha polypeptide 1 (muscle), SCCMS
Host Species Mouse
Immunogen CHRNA1 (NP_000070.1, 146 a.a. ~ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRLP
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 1134
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.