missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Niban Polyclonal antibody specifically detects Niban in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | Niban |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | C1orf24, cell growth inhibiting protein 39, Cell growth-inhibiting gene 39 protein, chromosome 1 open reading frame 24, family with sequence similarity 129, member A, GIG39, NIBANFLJ38228, Protein FAM129A, protein Niban |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VESYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHFPDPLASSEKENTQPFVVLPKEFPVYLWQPFFRHGYFCFHEAADQKRFSALLS |
| Purification Method | Immunogen affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?