missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NHE6/SLC9A6 Antibody (2D5), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00010479-M02
This item is not returnable.
View return policy
Description
NHE6/SLC9A6 Monoclonal antibody specifically detects NHE6/SLC9A6 in Human samples. It is validated for Western Blot, ELISA
Specifications
| NHE6/SLC9A6 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| MRSA, NHE6isoform 6, solute carrier family 9 (sodium/hydrogen exchanger), member 6, Solute carrier family 9 member 6 | |
| SLC9A6 (NP_006350, 602 a.a. ~ 669 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YGDSTVNTEPATSSAPRRFMGNSSEDALDRELAFGDHELVIRGTRLVLPMDDSEPPLNLLDNTRHGPA | |
| 0.1 mg | |
| Cancer, Endocrinology, Signal Transduction | |
| 10479 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
| Western Blot, ELISA | |
| 2D5 | |
| Western Blot 1:500 | |
| NP_006350 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction